DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc19

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:366 Identity:97/366 - (26%)
Similarity:147/366 - (40%) Gaps:74/366 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FYLTCILITGTSALFFAFDCPFLADSINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEA 110
            |.:|.:|.  .|.|||.|.|.:|..:...|.|.:...|:..|..||:...|:|||::.|.|..| 
Mouse    33 FNVTLLLF--LSGLFFGFPCRWLVQNGEWAFPAITGPLFILTFFSLVSLNFSDPGILHRGSTKE- 94

  Fly   111 AYIEKQIEVPNSLNSPTYRPPPRTKEVL-VKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFD 174
                                .|.|..|: |..:..:|::|..|...||||..||..|:.||:.||
Mouse    95 --------------------DPMTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVEDFD 139

  Fly   175 HHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVFNV---------IKA 230
            |||.||.||:|.||:|.|.|.::|   |.::..:..||.|..|.:..|..|::         :.|
Mouse   140 HHCKWVNNCIGHRNFRLFMLLVLS---LCLYSGALLVTCLTFLFRTRHLPFSLDKGMAILVAVPA 201

  Fly   231 APFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGSFSSKGGPRTQ-NPYSRGNICLNC 294
            |.|.:.:..:......||                  ...:.|:.||.....: ||:.:| ...|.
Mouse   202 AGFLIPLFLLLLIQALSV------------------SRAESSYESKCRYHPEYNPFDQG-FAKNW 247

  Fly   295 CHILCGPMTPSLID-----RRGIATDEFIQQMQHQSSPR---HALSDVLSASHMVTTSQPMMGGL 351
            ...:..|:.|:.:.     :|.:.| .:||:....|.||   |.........|     ||..  :
Mouse   248 YLAMFAPLGPNYMSEVVCLQRPVGT-AWIQEKTKPSPPRRPKHCRPGPPGPQH-----QPRR--V 304

  Fly   352 GGGGIGGAGGGISIGGAELKPRFYDES--NPSSSTLEGNGG 390
            .|.|..|:|...::......|...::|  .|...|.|...|
Mouse   305 PGKGPPGSGEAAALQEMRRLPASVEKSPGGPRQPTAEPAAG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 40/132 (30%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 33/74 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347 19/78 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.