DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc22

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001074412.1 Gene:Zdhhc22 / 238331 MGIID:2685108 Length:263 Species:Mus musculus


Alignment Length:265 Identity:60/265 - (22%)
Similarity:101/265 - (38%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YLTCI-LITGTSALFFAF----DCPFLADSINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRAS 106
            |..|| |:|....||...    :.|......:||: :.||:..|.:.::|               
Mouse    14 YFLCISLVTFVLQLFLFLPSMREDPTATPLFSPAV-LHGALFLFLSANAL--------------- 62

  Fly   107 NDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASH-CSLCDNCV 170
               ..|:......|:.|.:             .:|...:...|       ||.::| |.:|....
Mouse    63 ---GNYVLVIQNSPDDLGT-------------CQGTMSQRPQC-------PPPSTHFCRVCSRVT 104

  Fly   171 DRFDHHCPWVGNCVGKRNYRFFYLF------------LVSLAFLAVFIFSCSVTH----LVLLMK 219
            .|.||||.:.|||:|.||.|.|.||            :..:|:::. :.|.|..|    |.||..
Mouse   105 LRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLYSMVAGVAYISA-VLSISFAHPLAFLTLLPT 168

  Fly   220 KEHEVFN--VIKAAPFTVIVVFICFFSIWSVIGL--AGF--HTYLTTSDQTTNEDLKGSFSSKGG 278
            ...:.|:  |:.:..|.:::::     :|..:||  |||  |..|......|...::...:.:..
Mouse   169 SISQFFSGAVLGSDMFVILMLY-----LWFAVGLACAGFCCHQLLLILRGQTRYQVRKGMAVRAR 228

  Fly   279 PRTQN 283
            |..:|
Mouse   229 PWRKN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 40/146 (27%)
Zdhhc22NP_001074412.1 DHHC 91..218 CDD:366691 38/132 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.