DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and Zdhhc9

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_766053.1 Gene:Zdhhc9 / 208884 MGIID:2444393 Length:364 Species:Mus musculus


Alignment Length:352 Identity:185/352 - (52%)
Similarity:241/352 - (68%) Gaps:20/352 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SNMAPNQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINP 74
            |.|...::||||||...|||.|.|||.:|.|...|:||||..||.||..|||||:|.:||..::|
Mouse     2 SVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSP 66

  Fly    75 AIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLV 139
            |||:..|:|:.|:|::||||:|:||||||||..||||:||.:||..|.......|||||.|...:
Mouse    67 AIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQI 131

  Fly   140 KGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAV 204
            ..|.||||||:||||||||||||||:|||||:|||||||||||||||||||:||||::||:.|.:
Mouse   132 NNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTI 196

  Fly   205 FIFSCSVTHLVLLMKKEHEV--FNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNE 267
            ::|:.::.::.|   |..::  ...:|..|.||:.|.||||::|||:||.||||:|...:|||||
Mouse   197 YVFAFNIVYVAL---KSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNE 258

  Fly   268 DLKGSFSSKGGPRTQNPYSRGNICLNCCHILCGPMTPSLIDRRGI-----------ATDEFIQQM 321
            |:|||::.|.  |.|||||.|||..|||.:||||:.||::|||||           :|.|....:
Mouse   259 DIKGSWTGKN--RVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSL 321

  Fly   322 QHQS--SPRHALSDVLSASHMVTTSQP 346
            ..||  |..|..|:.::....:....|
Mouse   322 LPQSPASTEHMNSNEMAEDTSIPEEMP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 77/125 (62%)
Zdhhc9NP_766053.1 DHHC 138..261 CDD:396215 77/125 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364 8/46 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 201 1.000 Domainoid score I3001
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 1 1.000 - - otm44215
orthoMCL 1 0.900 - - OOG6_100625
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 1 1.000 - - X394
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.