DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and dhhc-4

DIOPT Version :10

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001023033.1 Gene:dhhc-4 / 191420 WormBaseID:WBGene00014075 Length:405 Species:Caenorhabditis elegans


Alignment Length:39 Identity:16/39 - (41%)
Similarity:23/39 - (58%) Gaps:7/39 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DGSSLPGRSGSFSKSSPSELDVVD------PYKRISSPG 40
            ||.|:.| :|.:|||:.||:..:|      .|.:.||||
 Worm   178 DGYSVAG-NGEYSKSAVSEIVEIDVPASAGSYMKSSSPG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 DHHC 146..270 CDD:396215
dhhc-4NP_001023033.1 DHHC 131..274 CDD:396215 16/39 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.