DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and dhhc-9

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001362080.1 Gene:dhhc-9 / 183426 WormBaseID:WBGene00016620 Length:313 Species:Caenorhabditis elegans


Alignment Length:147 Identity:43/147 - (29%)
Similarity:66/147 - (44%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVFI----FS 208
            :|..|..::...|.|||:|:.||...||||.|:..|||..|:|.|:||:.:|...|..|    :.
 Worm   111 FCSKCNYWKSDNAHHCSVCEKCVLGMDHHCIWINQCVGLHNHRHFFLFIANLTLAAATIIIAGYQ 175

  Fly   209 CSVTHLVLLMKKEHEVFNVIKAAPFTVIVVFICFFSIWSVI--------------GLAGFHTYLT 259
            ....||.|...:......:::.||...|:.....|:..||:              ||..::.||.
 Worm   176 SFSDHLFLESSQTTYCTTILEHAPLQDIICDYDGFARTSVVFCYLLSGILLVMVGGLTSWNIYLI 240

  Fly   260 TSDQTTNEDLKGSFSSK 276
            :...|..:.||.:.|.|
 Worm   241 SIGCTYIDYLKLTGSKK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 39/139 (28%)
dhhc-9NP_001362080.1 DHHC 106..251 CDD:366691 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.