DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and ZDHHC19

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:296 Identity:84/296 - (28%)
Similarity:130/296 - (43%) Gaps:59/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PNQRVTRKW---ELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPA 75
            |...|.|.|   .|||..|                    .:|:...|.|||||.|.:||.:...|
Human    16 PLPLVPRPWFLPSLFAAFN--------------------VVLLVFFSGLFFAFPCRWLAQNGEWA 60

  Fly    76 IPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVL-V 139
            .|::...|:..|..||:...|:|||::.:.|.::.                     |.|..|: |
Human    61 FPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQG---------------------PLTVHVVWV 104

  Fly   140 KGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAV 204
            .....:|::|..|...||||..||..|:.||:.|||||.||.||:|.||:|||.|.::|   |.:
Human   105 NHGAFRLQWCPKCCFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLS---LCL 166

  Fly   205 FIFSCSVTHLVLLMKKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTYLTTSDQTTNEDL 269
            :..:..||.|:.|::..|..|:..||     |.:.:...:...::.|:........|..:.:...
Human   167 YSGAMLVTCLIFLVRTTHLPFSTDKA-----IAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTY 226

  Fly   270 KGSFSSKGGPRTQNPYSRGNICLNCCHI-LCGPMTP 304
            ||......|   .||:.:|  |.:..:: :|.|:.|
Human   227 KGKCRHLQG---YNPFDQG--CASNWYLTICAPLGP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 41/123 (33%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 34/74 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.