DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment app and zdhhc22

DIOPT Version :9

Sequence 1:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_001340992.2 Gene:zdhhc22 / 100000886 ZFINID:ZDB-GENE-131127-476 Length:280 Species:Danio rerio


Alignment Length:267 Identity:64/267 - (23%)
Similarity:99/267 - (37%) Gaps:80/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FYLTCILITGTSALFFAFDCPFLADS----INPAIPIVGAVLYFFTMSSLLRT---TFTDPG--- 100
            ||...::   |.||.|....|.:..|    ||||: :....::.|.|.:.|..   |..:|.   
Zfish    19 FYAATVV---TFALHFLLFTPTIFQSSDVTINPAM-LAHISIFLFLMGNALGNYIMTIRNPSESA 79

  Fly   101 ---VIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASH 162
               |||..|.|          .|:.:::          ..|:.|:                  ..
Zfish    80 NETVIPVCSPD----------CPDRIDA----------HYLLNGR------------------HF 106

  Fly   163 CSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLF------------LVSLAFLAV---FIFSCSVT 212
            |.:|...:.:.||||.:.|||:|.||.|:|.:|            ::.:|:|.:   ..|...:|
Zfish   107 CKVCKKVILKRDHHCFFTGNCIGNRNMRYFIMFSIYTSSSCLYSLVIGVAYLTIEYSISFENPLT 171

  Fly   213 HLVLL-MKKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGL--AGF---HTYLTTSDQTTNEDLKG 271
            .|.|| :...:....:|....|.::::..    ||..|||  .||   ...|....||..|..||
Zfish   172 FLTLLPLSTGYFFLGLISGLQFFLVIMLY----IWLGIGLVSVGFCCQQLLLVARGQTWCELQKG 232

  Fly   272 SFSSKGG 278
            ..|...|
Zfish   233 QLSECRG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
appNP_648561.2 zf-DHHC 146..270 CDD:279823 35/144 (24%)
zdhhc22XP_001340992.2 zf-DHHC 105..233 CDD:307600 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.