DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ADK2

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_011097.3 Gene:ADK2 / 856917 SGDID:S000000972 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:54/206 - (26%)
Similarity:94/206 - (45%) Gaps:37/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILGGPGCGKGTQCAKIVEKY-GFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLL 100
            :||.||.|||||.::::::. ..:.:||||:||.|:.|.|..||:....:|.|.|:.:|.:..|:
Yeast    19 LLGAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLI 83

  Fly   101 N---DAITRAKGSSKGFLIDGYPRQKNQGIEFEARI----APADLALYFECSEDTMVQRIMAR-- 156
            .   .|:...|.|:. :|:||:||...|....:..:    |..:|.:..:..|.|:::||..|  
Yeast    84 TFRLSALGWLKPSAM-WLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYV 147

  Fly   157 -----------------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--T 196
                                   ......||.||..:..:.||..:|:....:.:.|:...:  |
Yeast   148 HVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGT 212

  Fly   197 INAERDVDDIF 207
            ::.|.. |.||
Yeast   213 VSGETS-DIIF 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 54/206 (26%)
ADK 34..206 CDD:238713 52/203 (26%)
ADK2NP_011097.3 adk 21..216 CDD:234711 49/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.