DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and URA6

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_012901.3 Gene:URA6 / 853844 SGDID:S000001507 Length:204 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:75/187 - (40%)
Similarity:118/187 - (63%) Gaps:6/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVA-SGSDKGRQLQAVMASGGLVSNDE 95
            :.:|::|||||.||||||.|:|:.|.|.|||:|||||.|.. :||..|..::..:..|.:|..:.
Yeast    16 VSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEI 80

  Fly    96 VLSLLNDAIT-RAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAA 159
            .|:||.:||: ..|.:...|||||:||:.:|.|.||..|..:...|:|:|.||.|::|::.|...
Yeast    81 TLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPEDIMLERLLERGKT 145

  Fly   160 SAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKT--LTINAERDVDDIFLEVVQAI 214
            |.  |.|||.::|:.|..|||:.:..::|.:|.|:  :.:..:|.|:|::.:|..||
Yeast   146 SG--RSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 75/187 (40%)
ADK 34..206 CDD:238713 71/175 (41%)
URA6NP_012901.3 UMP_CMP_kin_fam 18..196 CDD:273576 72/179 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.