DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ADK1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_010512.1 Gene:ADK1 / 851812 SGDID:S000002634 Length:222 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:50/184 - (27%)
Similarity:92/184 - (50%) Gaps:29/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLN 101
            ::|.||.|||||...:.|::...||::||:||:::|.|:..|.:.:.:|..|||||:|.:::::.
Yeast    11 LIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIK 75

  Fly   102 DAITRAKGSSKGFLIDGYPRQKNQGIEFEARI----APADLALYFECSEDTMVQRIMAR------ 156
            |.:|.......||::||:||...|..:.:..:    .|.:.|:..:..::.:|.||..|      
Yeast    76 DELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPAS 140

  Fly   157 -------------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYE 191
                               ...:.|:|.|||...::.||..:...|..|::.|:
Yeast   141 GRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 50/184 (27%)
ADK 34..206 CDD:238713 50/184 (27%)
ADK1NP_010512.1 adk 8..221 CDD:234711 50/184 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.