DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AT5G50370

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_199848.1 Gene:AT5G50370 / 835104 AraportID:AT5G50370 Length:248 Species:Arabidopsis thaliana


Alignment Length:230 Identity:69/230 - (30%)
Similarity:115/230 - (50%) Gaps:36/230 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LKAEELRRARAAA--DIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQ 80
            |.:|.|||.:.|:  |..:::| |.||.|||||...|.:::...|||:||:||..||:.:..|.:
plant    19 LMSELLRRMKCASKPDKRLVFI-GPPGSGKGTQSPVIKDEFCLCHLSTGDMLRAAVAAKTPLGVK 82

  Fly    81 LQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFE----ARIAPADLALY 141
            .:..|..|.|||:|.|:.::::|:.|.| ..|||::||:||...|..:.:    .|.|..|..|.
plant    83 AKEAMDKGELVSDDLVVGIMDEAMNRPK-CQKGFILDGFPRTVTQAEKLDEMLNRRGAQIDKVLN 146

  Fly   142 FECSEDTMVQRIMAR-------------------------AAASAVKRDDDNEKTIRARLLTFKQ 181
            |...:..:.:||..|                         .....::|.|||...:|:||..|.:
plant   147 FAIDDSVLEERITGRWIHPSSGRSYHTKFAPPKVPGVDDLTGEPLIQRKDDNADVLRSRLDAFHK 211

  Fly   182 NTNAILELYEPKTLTIN--AERDVDDIFLEVVQAI 214
            .|..:::.|..|...:|  ||:..::: .:||:.:
plant   212 QTQPVIDYYAKKENLVNIPAEKAPEEV-TKVVKKV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 63/218 (29%)
ADK 34..206 CDD:238713 60/202 (30%)
AT5G50370NP_199848.1 PLN02674 4..237 CDD:178279 67/219 (31%)
ADK 36..237 CDD:238713 60/202 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.