DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and PYR6

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_850867.1 Gene:PYR6 / 832710 AraportID:AT5G26667 Length:208 Species:Arabidopsis thaliana


Alignment Length:198 Identity:80/198 - (40%)
Similarity:118/198 - (59%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLS 98
            :|::|||||.|||||||.|||.||:||||:|||||.|:.|||:.|..:|.::..|.:|.::..:.
plant    16 VIFVLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIK 80

  Fly    99 LLNDAITRAKGSSKGFLIDGYPRQKNQGIEFE--ARIAPADLALYFECSEDTMVQRIMARAAASA 161
            ||..|| :..|:.| |||||:||.:.....||  ..|.| ...|:|:|.|:.|.:|::.|...  
plant    81 LLQKAI-QENGNDK-FLIDGFPRNEENRAAFEKVTEIEP-KFVLFFDCPEEEMEKRLLGRNQG-- 140

  Fly   162 VKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAERDVDDIFLEVVQAIDCVLKKKQQN 224
              |:|||.:|||.|...|.:::..::..||.  |...|||.:.::.:|.||........:|.:.|
plant   141 --REDDNIETIRKRFKVFLESSLPVIHYYEAKGKVRKINAAKPIEAVFEEVKAIFSPEAEKVKLN 203

  Fly   225 AAA 227
            :.|
plant   204 SCA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 77/186 (41%)
ADK 34..206 CDD:238713 74/175 (42%)
PYR6NP_850867.1 UMP_CMP_kin_fam 16..194 CDD:273576 77/184 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.