DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AT3G60180

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_567093.1 Gene:AT3G60180 / 825188 AraportID:AT3G60180 Length:204 Species:Arabidopsis thaliana


Alignment Length:185 Identity:76/185 - (41%)
Similarity:118/185 - (63%) Gaps:12/185 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLS 98
            ::::|||||.|||||||.:|:.:.:||.|:|||||.|:.|||:.|..:|:::|.|.:|.::..:.
plant    23 VVFVLGGPGSGKGTQCANVVKHFSYTHFSAGDLLRAEIKSGSEFGAMIQSMIAEGRIVPSEITVK 87

  Fly    99 LLNDAITRAKGSSKGFLIDGYPRQKNQGIEFE--ARIAPADLALYFECSEDTMVQRIMARAAASA 161
            ||..|:..: |:.| |||||:||.:.....||  |||.|| ..|:|:|.|:.:.:|||:|...  
plant    88 LLCKAMEES-GNDK-FLIDGFPRNEENRNVFENVARIEPA-FVLFFDCPEEELERRIMSRNQG-- 147

  Fly   162 VKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAERDVDDIFLEVVQAI 214
              |:|||.:||:.|...|.::|..|:..||.  |...|||.:..:::| |.|:.:
plant   148 --REDDNIETIKKRFKVFVESTLPIISYYESKGKLRKINAAKSSEEVF-EAVRVL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 76/185 (41%)
ADK 34..206 CDD:238713 73/175 (42%)
AT3G60180NP_567093.1 UMP_CMP_kin_fam 23..201 CDD:273576 76/185 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.