DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and Cmpk1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_079923.3 Gene:Cmpk1 / 66588 MGIID:1913838 Length:227 Species:Mus musculus


Alignment Length:194 Identity:72/194 - (37%)
Similarity:118/194 - (60%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVAS-GSDKGRQLQAVMASGGLVSNDEVL 97
            ::::|||||.|||||||:||||||:||||:|:|||:|..: .|..|..::..:..|.:|..:..:
Mouse    36 VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITI 100

  Fly    98 SLLN---DAITRAKGSSKGFLIDGYPRQK------NQGIEFEARIAPADLALYFECSEDTMVQRI 153
            |||.   |....|......|||||:||.:      |:.::.:|.::   ..|:|:|:.:..::|.
Mouse   101 SLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVS---FVLFFDCNNEICIERC 162

  Fly   154 MARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAERDVDDIFLEVVQAID 215
            :.|..:|.  |.|||.:::..|:.|:.::|..|::|||.  |...|:|.:.||::|.|||:..|
Mouse   163 LERGKSSG--RSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDASKSVDEVFGEVVKIFD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 72/194 (37%)
ADK 34..206 CDD:238713 67/183 (37%)
Cmpk1NP_079923.3 UMP_CMP_kin_fam 36..224 CDD:273576 71/192 (37%)
ADK 36..215 CDD:238713 67/183 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833693
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.660

Return to query results.
Submit another query.