DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AT3G60961

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001118870.1 Gene:AT3G60961 / 6241017 AraportID:AT3G60961 Length:136 Species:Arabidopsis thaliana


Alignment Length:138 Identity:49/138 - (35%)
Similarity:79/138 - (57%) Gaps:14/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VMASGGLVSNDEVLSLLNDAIT---RAKGSSKGFLIDGYPRQKNQGIEFE--ARIAPADLALYFE 143
            ::|.|.:|.::..:.||..|:.   :..|:.| |||||:||.:...|.||  |||.|| ..|:|:
plant     1 MIAEGRIVPSEITVKLLCKAMEESFQVSGNDK-FLIDGFPRNEENRIVFENVARIEPA-FVLFFD 63

  Fly   144 CSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAERDVDDI 206
            |.|:.:.:|||:|...    |:|||.:||:.|...|.::|..|:..|:.  |...|||.:..:::
plant    64 CPEEELERRIMSRNQG----REDDNIETIKKRFKVFVESTLPIISYYQSKGKLRKINAAKSSEEV 124

  Fly   207 FLEVVQAI 214
            | |.|:.:
plant   125 F-EAVRVL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 49/138 (36%)
ADK 34..206 CDD:238713 46/128 (36%)
AT3G60961NP_001118870.1 ADK <1..124 CDD:238713 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.