DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ak9

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_685909.5 Gene:ak9 / 557708 ZFINID:ZDB-GENE-041014-337 Length:1762 Species:Danio rerio


Alignment Length:226 Identity:57/226 - (25%)
Similarity:100/226 - (44%) Gaps:28/226 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRRARAAADIPI-IWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLR---NEVASGSDKGRQLQA 83
            ||:.|....:|| :.|:|.|..||.|.......:||.|.||.||.:|   |..|. :|...|:|.
Zfish  1246 LRQPRPNPSLPIKLAIIGPPKSGKTTVAQAFAREYGLTRLSIGDAIRMVLNSQAK-TDLACQVQI 1309

  Fly    84 VMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDT 148
            .:..|..|.::..:..:..|:.....:::||::||:|..|:|....|:.|.|   .:..|...||
Zfish  1310 HLKQGQTVPDELAIQCVEVAVMNLVCTTRGFVLDGFPVTKHQAELLESCIIP---MVVVELQLDT 1371

  Fly   149 MVQRIMARAAASAVKRD------DDNEKTIRARLLTFKQNTNAI-LELYEP----------KTLT 196
            :  .::.|......|.:      .|:.:.:..|...|:|...|: |.|:..          |:..
Zfish  1372 V--EVLKRGLRDREKNNRSHQVHHDSLQALNIRNSCFRQEAEALRLHLHNQYHNWTPVDAHKSKW 1434

  Fly   197 INAERDVDDIFLEVVQAIDCVLKKKQQNAAA 227
            ...||.:|::.:. ::.|...|::..:..||
Zfish  1435 WVQERILDEVRIS-MRHIHSYLERIHKGQAA 1464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 51/207 (25%)
ADK 34..206 CDD:238713 49/192 (26%)
ak9XP_685909.5 adk 33..280 CDD:273569
ADK 33..276 CDD:238713
AAA_17 394..504 CDD:289950
DUF3508 <717..804 CDD:288841
Ribosomal_L24e_L24 <775..808 CDD:294589
NK 816..>983 CDD:302627
Adk 1258..1445 CDD:223637 48/192 (25%)
ADK 1258..1432 CDD:238713 44/179 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.