DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and CMPK1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_057392.1 Gene:CMPK1 / 51727 HGNCID:18170 Length:228 Species:Homo sapiens


Alignment Length:227 Identity:79/227 - (34%)
Similarity:126/227 - (55%) Gaps:39/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LFMCHQRVMKKEAEEKLKAEELRRARAAADIP-IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGD 65
            :.:|..|:||                     | ::::|||||.|||||||:||||||:||||:|:
Human    25 ILLCSPRLMK---------------------PLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGE 68

  Fly    66 LLRNEVAS-GSDKGRQLQAVMASGGLVSNDEVLSLLN---DAITRAKGSSKGFLIDGYPRQK--- 123
            |||:|..: .|..|..::..:..|.:|..:..:|||.   |....|......|||||:||.:   
Human    69 LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNL 133

  Fly   124 ---NQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNA 185
               |:.::.:|.::   ..|:|:|:.:..::|.:.|..:|.  |.|||.:::..|:.|:.|:|..
Human   134 QGWNKTMDGKADVS---FVLFFDCNNEICIERCLERGKSSG--RSDDNRESLEKRIQTYLQSTKP 193

  Fly   186 ILELYEP--KTLTINAERDVDDIFLEVVQAID 215
            |::|||.  |...|:|.:.||::|.||||..|
Human   194 IIDLYEEMGKVKKIDASKSVDEVFDEVVQIFD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 75/199 (38%)
ADK 34..206 CDD:238713 68/183 (37%)
CMPK1NP_057392.1 UMP_CMP_kin_fam 37..225 CDD:273576 73/192 (38%)
ADK 37..216 CDD:238713 68/183 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.660

Return to query results.
Submit another query.