DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AK3

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_057366.2 Gene:AK3 / 50808 HGNCID:17376 Length:227 Species:Homo sapiens


Alignment Length:217 Identity:56/217 - (25%)
Similarity:97/217 - (44%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLN 101
            |:|.||.||||..::|...:...|||||||||:.:..|::.|...:|.:..|.|:.:|.:..|  
Human    12 IMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRL-- 74

  Fly   102 DAITRAKGSSK-GFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMAR--------- 156
             |:...|..:: .:|:||:||...|. |...|....|..:......:.:.||:.||         
Human    75 -ALHELKNLTQYSWLLDGFPRTLPQA-EALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRV 137

  Fly   157 ----------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPK-TLTINAERDVD 204
                            .....::|:||..:|:..||..::..|..:||.|:.| .|...:..:.:
Human   138 YNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETN 202

  Fly   205 DIFLEVVQAIDCVLKKKQQNAA 226
            .|:..|...:...:.::.|.|:
Human   203 KIWPYVYAFLQTKVPQRSQKAS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 54/206 (26%)
ADK 34..206 CDD:238713 52/195 (27%)
AK3NP_057366.2 ADK 12..190 CDD:395329 50/181 (28%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 37..66 11/28 (39%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 127..164 3/36 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.