DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ak7b

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001103168.2 Gene:ak7b / 504040 ZFINID:ZDB-GENE-050309-170 Length:699 Species:Danio rerio


Alignment Length:246 Identity:53/246 - (21%)
Similarity:97/246 - (39%) Gaps:51/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELRRARAAADIPI-IWILGGPGCGKGTQCAKIVEKYGFTHL----SSGDLLRN--------EVA 72
            ||.:.:|..  :|| :.|:|.|..||.|...||.:.|...|:    :..:.|.|        :..
Zfish   351 EEYKESRGL--LPIRMCIVGPPAVGKSTIAEKICKHYNLHHIKLKEAIAEALENLELCVRTEDEE 413

  Fly    73 SGSDKGRQL-----QAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIE-FEA 131
            :..|..::.     :.:..:||.:.:..|:.::.|.:......::||::||:|:...|..| |..
Zfish   414 NDQDDDQEFWDTLRENMNENGGRLDDQYVIRIMKDKLRTKPCMNQGFVLDGFPKTCEQAKELFTG 478

  Fly   132 RIAPADL------------ALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQ--- 181
            ...|.||            ......::|.:..|:: ....:.|:......:....||..|:.   
Zfish   479 DGEPEDLESKHATKIIPEFVFSVNATDDFLKNRVL-NLPETVVEGTSYMPEQFLQRLARFRDRNV 542

  Fly   182 ------NTNAILELYEPKTLTINAERDVDDIFLEVVQAIDCVLKK--KQQN 224
                  |....||:: |:.|.|.::.|     .|....||.:.||  |.:|
Zfish   543 EDEMPLNYFEDLEIH-PEHLEITSDND-----NEYQLIIDKICKKVGKPRN 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 46/226 (20%)
ADK 34..206 CDD:238713 42/211 (20%)
ak7bNP_001103168.2 WcaG <129..>286 CDD:223528
NADB_Rossmann <212..286 CDD:304358
Adk 363..583 CDD:223637 46/226 (20%)
ADK 363..556 CDD:238713 36/193 (19%)
Dpy-30 656..697 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.