DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ak1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_031746217.1 Gene:ak1 / 448536 XenbaseID:XB-GENE-1012039 Length:566 Species:Xenopus tropicalis


Alignment Length:211 Identity:99/211 - (46%)
Similarity:136/211 - (64%) Gaps:4/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VMKKEAEEKLKAEELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVAS 73
            |.::|.|.....|....|....:..||:::||||.||||||.|||.:||:||||:|||||.||:|
 Frog   357 VPQQEIEVVFSPEHTEMADKLKNSKIIFVVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSS 421

  Fly    74 GSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADL 138
            ||::|:.|.|:|..|.||..|.||.:|.:|:.....:|||:|||||||:..||.|||.:|.|..|
 Frog   422 GSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSL 486

  Fly   139 ALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLT--INAER 201
            .||.:...||||:|::.|...|.  |.||||.||:.||.|:.:.|..::.:||.:.:.  ||||.
 Frog   487 LLYIDAGSDTMVKRLLKRGETSG--RADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEG 549

  Fly   202 DVDDIFLEVVQAIDCV 217
            .|||:|.:|..|:|.:
 Frog   550 SVDDVFKQVSTALDAL 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 94/188 (50%)
ADK 34..206 CDD:238713 89/173 (51%)
ak1XP_031746217.1 aden_kin_iso1 129..312 CDD:130427
aden_kin_iso1 378..565 CDD:130427 94/188 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3838
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20135
Inparanoid 1 1.050 189 1.000 Inparanoid score I3777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0005806
OrthoInspector 1 1.000 - - oto104128
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4196
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.