DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and Dak1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_651456.1 Gene:Dak1 / 43165 FlyBaseID:FBgn0028833 Length:253 Species:Drosophila melanogaster


Alignment Length:190 Identity:69/190 - (36%)
Similarity:115/190 - (60%) Gaps:23/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVA-SGSDKGRQLQAVMASGGLVSNDEVL 97
            |:::|||||.||||||::||:::.|||||:|||||.|.: .||:.|..::..:.:|.:|..:...
  Fly    65 IVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTC 129

  Fly    98 SLLNDAITRAKGSSKGFLIDGYP----------RQKNQGIEFEARIAPADLALYFECSEDTMVQR 152
            |||.:|: :|.|.|: |||||:|          ||.::.::|:       ..|:|:|.||..|:|
  Fly   130 SLLENAM-KASGKSR-FLIDGFPRNQDNLDGWNRQMSEKVDFQ-------FVLFFDCGEDVCVKR 185

  Fly   153 IMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYE--PKTLTINAERDVDDIFLEV 210
            .:.| ..|...|.|||..:::.|:.|:..::..|::.:|  .:...|:|..|.:::|.||
  Fly   186 CLGR-GQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 69/190 (36%)
ADK 34..206 CDD:238713 66/184 (36%)
Dak1NP_651456.1 UMP_CMP_kin_fam 65..249 CDD:273576 69/190 (36%)
ADK 65..240 CDD:238713 66/184 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103442at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 1 1.100 - - P PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.