DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ak3

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_998295.2 Gene:ak3 / 406404 ZFINID:ZDB-GENE-040426-2142 Length:225 Species:Danio rerio


Alignment Length:183 Identity:50/183 - (27%)
Similarity:88/183 - (48%) Gaps:30/183 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLN 101
            |:|.||.||||..::|.:.:|..||||||:||..:.:.:|.|..:::.:..|.||.:|.:..|: 
Zfish    11 IMGAPGSGKGTVSSRIAQSFGLKHLSSGDMLRANIEAKTDLGLLMKSCIDQGQLVPDDVISRLI- 74

  Fly   102 DAITRAKGSSK-GFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMAR--------- 156
              ::..:|..| .:|:||:||...|....:. :...|..:..:....|:.:|:.:|         
Zfish    75 --LSSLRGLEKTSWLLDGFPRTVAQAEALDC-VYDVDSVINLDVPFQTIRERLTSRWVHLPSGRV 136

  Fly   157 ----------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPK 193
                            .....|:||||:.:|:..||..:::.|..:||.|..|
Zfish   137 YNIDFNPPKKPGLDDVTGEPLVQRDDDSPETVSRRLKDYERQTQPVLEYYRSK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 50/183 (27%)
ADK 34..206 CDD:238713 50/183 (27%)
ak3NP_998295.2 ADK 8..200 CDD:238713 50/183 (27%)
adk 8..198 CDD:234711 50/183 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.