DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and cmpk

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_998274.2 Gene:cmpk / 406383 ZFINID:ZDB-GENE-040426-2113 Length:219 Species:Danio rerio


Alignment Length:210 Identity:80/210 - (38%)
Similarity:122/210 - (58%) Gaps:14/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EKLKAEELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVA-SGSDKGR 79
            ||| ...|.|.|......::::|||||.|||||||:|||.|.:||||:|||||.|.: :.|:.|:
Zfish    11 EKL-PRVLHRLRVIMKPQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQ 74

  Fly    80 QLQAVMASGGLVSNDEVLSLLNDAITRA-KGSSK--GFLIDGYPRQKN--QG--IEFEARIAPAD 137
            .:.:.:..|.:|.....::||..|:... |...|  .|||||:||.::  ||  .|.:.: |...
Zfish    75 LIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGK-ADVK 138

  Fly   138 LALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAE 200
            ..|:|:||.:..:.|.:.|..:|.  |.|||.:::..|:.|:.|:|..|:||||.  |...|:|.
Zfish   139 FVLFFDCSNEVCIDRCLERGKSSG--RTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDAS 201

  Fly   201 RDVDDIFLEVVQAID 215
            |.||::|.:|...::
Zfish   202 RSVDEVFADVKNILE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 74/196 (38%)
ADK 34..206 CDD:238713 72/181 (40%)
cmpkNP_998274.2 UMP_CMP_kin_fam 28..215 CDD:273576 74/189 (39%)
ADK 28..207 CDD:238713 72/181 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.