DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and LOC390877

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_016882293.1 Gene:LOC390877 / 390877 -ID:- Length:158 Species:Homo sapiens


Alignment Length:95 Identity:40/95 - (42%)
Similarity:60/95 - (63%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLL 100
            | :|||||||||||..:..||||.|:....|||.|....:.:|||::.:...|.||....:..::
Human    44 W-MGGPGCGKGTQCKNMATKYGFCHVGLDQLLRQEAQRSTQRGRQIRDITLQGLLVPAGIIPDMV 107

  Fly   101 NDAITRAKGSSKGFLIDGYPRQKNQGIEFE 130
            :|.:. ::..|:||||||:|::..|.:|||
Human   108 SDNML-SRPESRGFLIDGFPQEVKQAMEFE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 40/95 (42%)
ADK 34..206 CDD:238713 40/95 (42%)
LOC390877XP_016882293.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.