DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and Ak5

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001102421.1 Gene:Ak5 / 365985 RGDID:1590818 Length:562 Species:Rattus norvegicus


Alignment Length:199 Identity:86/199 - (43%)
Similarity:129/199 - (64%) Gaps:10/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVM 85
            |:||:.:      ||:::||||.||||||.|:.|||||||||:|:|||.|:.|.|::.:.::.:|
  Rat   371 EDLRKCK------IIFLMGGPGSGKGTQCEKLAEKYGFTHLSTGELLRQELTSESERSKLIRDIM 429

  Fly    86 ASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMV 150
            ..|.||.:..||.||.:|:..:.|::||||||||||:..||.||..||....|.:..:||.|||.
  Rat   430 ERGDLVPSGVVLELLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGEPQLVICMDCSADTMT 494

  Fly   151 QRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKT--LTINAERDVDDIFLEVVQA 213
            .|::.|:.:|  :|.:|:.|::..||..:.:.:..::..||.||  ..:|||...|.:||::..|
  Rat   495 NRLLQRSQSS--QRGEDSAKSVAKRLEAYHRASIPVIAYYETKTQLQKVNAEGTPDQVFLQLCTA 557

  Fly   214 IDCV 217
            ||.|
  Rat   558 IDSV 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 82/188 (44%)
ADK 34..206 CDD:238713 77/173 (45%)
Ak5NP_001102421.1 aden_kin_iso1 133..316 CDD:130427
ADK 134..307 CDD:238713
aden_kin_iso1 374..561 CDD:130427 83/194 (43%)
ADK 378..550 CDD:238713 77/173 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3913
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45648
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.