DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and CG9541

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001260273.1 Gene:CG9541 / 34220 FlyBaseID:FBgn0032083 Length:646 Species:Drosophila melanogaster


Alignment Length:192 Identity:56/192 - (29%)
Similarity:90/192 - (46%) Gaps:21/192 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ELRRA----RAAADI-PIIWILGGPGCGKGTQCAKIVE-KYGFTHLSSGDLLRNEVASGSDKGRQ 80
            :||:|    .:.:|: ||||::||||..|.|.|.|.|. ..|:.|:|.|.||||...|......:
  Fly   342 KLRQAAGPDESGSDLPPIIWVIGGPGSNKATLCLKAVGLNPGWAHISVGRLLRNITDSAPRANTE 406

  Fly    81 LQAV---MASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYF 142
            ..||   :|:|.:.....:..||...:.:.:..: |.::|||||...|...||.:.......:..
  Fly   407 SFAVKEALAAGDMAPEKSLNQLLETNLRQLRDRT-GIIVDGYPRNLQQVKYFENKYKQRPPIILL 470

  Fly   143 ECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLTINAERDVD 204
            :||:   :|  :.|.      |.||...:.|.||..|::.|..:|::.:........:.|.|
  Fly   471 DCSK---LQ--LGRG------RIDDTVSSFRRRLELFREQTLPMLKILDTSNRLQIVDGDTD 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 53/180 (29%)
ADK 34..206 CDD:238713 51/175 (29%)
CG9541NP_001260273.1 aden_kin_iso1 67..238 CDD:130427
ADK 70..230 CDD:238713
aden_kin_iso1 358..521 CDD:130427 51/174 (29%)
ADK 359..521 CDD:238713 50/173 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451278
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.