DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ak2

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_997761.1 Gene:ak2 / 321793 ZFINID:ZDB-GENE-030131-512 Length:241 Species:Danio rerio


Alignment Length:224 Identity:69/224 - (30%)
Similarity:110/224 - (49%) Gaps:42/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLN 101
            :||.||.|||||..|:.|||...||::||:||..|||||:.|::|:..|.:|.|||::.|:.|::
Zfish    22 LLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVSDEMVVELID 86

  Fly   102 DAITRAKGSSKGFLIDGYPRQKNQGIE----FEARIAPADLALYFECSEDTMVQRIMAR------ 156
            :.:. ......|||:||:||...|...    .|.|....|..:.|...:..:|:||..|      
Zfish    87 NNLD-TPSCKNGFLLDGFPRTVKQAEMLDDLMEKRSEKLDSVIEFSVDDSLLVRRICGRLIHQPS 150

  Fly   157 -------------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAE 200
                               .....::|.||||.|:|:||.::.:.|:.:::.|..:.|  .|:|.
Zfish   151 GRSYHEEFHPPKEHMKDDVTGEPLIRRSDDNETTLRSRLESYHRQTSPLVQYYSARGLHTAIDAS 215

  Fly   201 RDVDDIFLEVVQAIDCVLKKKQQNAAAQC 229
            :..|.:|..::.|.          :||.|
Zfish   216 QSTDLVFASILAAF----------SAATC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 66/210 (31%)
ADK 34..206 CDD:238713 64/199 (32%)
ak2NP_997761.1 adk 19..231 CDD:234711 66/219 (30%)
ADK 19..221 CDD:238713 64/199 (32%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 47..76 13/28 (46%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 143..180 2/36 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..180 1/27 (4%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.