DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and Cmpk1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001020826.1 Gene:Cmpk1 / 298410 RGDID:1310116 Length:227 Species:Rattus norvegicus


Alignment Length:194 Identity:70/194 - (36%)
Similarity:117/194 - (60%) Gaps:17/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVAS-GSDKGRQLQAVMASGGLVSNDEVL 97
            ::::|||||.|||||||:||||||:||||:|:|||:|..: .|..|..::..:..|.:|..:..:
  Rat    36 VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITI 100

  Fly    98 SLLN---DAITRAKGSSKGFLIDGYPRQK------NQGIEFEARIAPADLALYFECSEDTMVQRI 153
            |||.   |....|......|||||:||.:      |:.::.:|.::   ..|:|:|:.:..:.|.
  Rat   101 SLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVS---FVLFFDCNNEICIDRC 162

  Fly   154 MARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAERDVDDIFLEVVQAID 215
            :.|..:|.  |.|||.:::..|:.|:.::|..|::|||.  |...|:|.:.||::|.:|::..|
  Rat   163 LERGKSSG--RSDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKIDASKSVDEVFGDVMKIFD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 70/194 (36%)
ADK 34..206 CDD:238713 67/183 (37%)
Cmpk1NP_001020826.1 UMP_CMP_kin_fam 36..224 CDD:273576 69/192 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337280
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.660

Return to query results.
Submit another query.