DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AK5

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_777283.1 Gene:AK5 / 26289 HGNCID:365 Length:562 Species:Homo sapiens


Alignment Length:199 Identity:90/199 - (45%)
Similarity:128/199 - (64%) Gaps:10/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVM 85
            |:||:.:      ||:|:||||.||||||.|:||||||||||:|:|||.|:||.|::.:.::.:|
Human   371 EDLRKCK------IIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIM 429

  Fly    86 ASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMV 150
            ..|.||.:..||.||.:|:..:.|.::|||||||||:..||.||..||....|.:..:||.|||.
Human   430 ERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMT 494

  Fly   151 QRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAERDVDDIFLEVVQA 213
            .|::.|:.:|...  ||..|||..||..:.:.:..::..||.||.  .||||...:|:||::..|
Human   495 NRLLQRSRSSLPV--DDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTA 557

  Fly   214 IDCV 217
            ||.:
Human   558 IDSI 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 87/188 (46%)
ADK 34..206 CDD:238713 81/173 (47%)
AK5NP_777283.1 aden_kin_iso1 133..316 CDD:130427
Adenylate kinase 1. /evidence=ECO:0000305|PubMed:19647735 133..316
ADK 134..307 CDD:238713
NMP 1. /evidence=ECO:0000250|UniProtKB:P00568 162..193
LID 1. /evidence=ECO:0000250|UniProtKB:P00568 256..266
aden_kin_iso1 374..561 CDD:130427 88/194 (45%)
Adenylate kinase 2. /evidence=ECO:0000305|PubMed:19647735 377..559 85/189 (45%)
ADK 378..550 CDD:238713 81/173 (47%)
NMP 2. /evidence=ECO:0000269|Ref.9 406..435 11/28 (39%)
LID 2. /evidence=ECO:0000269|Ref.9 499..509 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3970
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41526
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.