Sequence 1: | NP_729792.1 | Gene: | Adk1 / 39396 | FlyBaseID: | FBgn0022709 | Length: | 229 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_777283.1 | Gene: | AK5 / 26289 | HGNCID: | 365 | Length: | 562 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 90/199 - (45%) |
---|---|---|---|
Similarity: | 128/199 - (64%) | Gaps: | 10/199 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 EELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVM 85
Fly 86 ASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMV 150
Fly 151 QRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAERDVDDIFLEVVQA 213
Fly 214 IDCV 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk1 | NP_729792.1 | aden_kin_iso1 | 30..217 | CDD:130427 | 87/188 (46%) |
ADK | 34..206 | CDD:238713 | 81/173 (47%) | ||
AK5 | NP_777283.1 | aden_kin_iso1 | 133..316 | CDD:130427 | |
Adenylate kinase 1. /evidence=ECO:0000305|PubMed:19647735 | 133..316 | ||||
ADK | 134..307 | CDD:238713 | |||
NMP 1. /evidence=ECO:0000250|UniProtKB:P00568 | 162..193 | ||||
LID 1. /evidence=ECO:0000250|UniProtKB:P00568 | 256..266 | ||||
aden_kin_iso1 | 374..561 | CDD:130427 | 88/194 (45%) | ||
Adenylate kinase 2. /evidence=ECO:0000305|PubMed:19647735 | 377..559 | 85/189 (45%) | |||
ADK | 378..550 | CDD:238713 | 81/173 (47%) | ||
NMP 2. /evidence=ECO:0000269|Ref.9 | 406..435 | 11/28 (39%) | |||
LID 2. /evidence=ECO:0000269|Ref.9 | 499..509 | 2/11 (18%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 163 | 1.000 | Domainoid score | I3970 |
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1378291at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm41526 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.820 |