DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and SPCC1795.05c

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001342723.1 Gene:SPCC1795.05c / 2538942 PomBaseID:SPCC1795.05c Length:191 Species:Schizosaccharomyces pombe


Alignment Length:187 Identity:72/187 - (38%)
Similarity:115/187 - (61%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIWILGGPGCGKGTQCAKIVEKYG-FTHLSSGDLLRNEV-ASGSDKGRQLQAVMASGGLVSNDEV 96
            :|::|||||.||||||.::.||:. |.|:|:||.||.|. ..||..|..::..:..|.:|..:..
pombe     4 VIFVLGGPGAGKGTQCDRLAEKFDKFVHISAGDCLREEQNRPGSKYGNLIKEYIKDGKIVPMEIT 68

  Fly    97 LSLLNDAITRA--KGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAA 159
            :|||...:...  ||..| |||||:||:.:|...||..:.||..||||.|.::||::|::.|...
pombe    69 ISLLETKMKECHDKGIDK-FLIDGFPREMDQCEGFEKSVCPAKFALYFRCGQETMLKRLIHRGKT 132

  Fly   160 SAVKRDDDNEKTIRARLLTFKQNTNAILELY--EPKTLTINAERDVDDIFLEVVQAI 214
            |.  |.|||.::|:.|.:|:.:.:..::|..  :.:.:||:||:|.|.:|.:.|:|:
pombe   133 SG--RSDDNIESIKKRFVTYTKASMPVVEYLKSQNRLITIDAEQDPDAVFEDTVKAL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 72/187 (39%)
ADK 34..206 CDD:238713 69/177 (39%)
SPCC1795.05cNP_001342723.1 ADK 4..187 CDD:331878 71/185 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.