DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and Ak2

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_112248.2 Gene:Ak2 / 24184 RGDID:2077 Length:239 Species:Rattus norvegicus


Alignment Length:208 Identity:62/208 - (29%)
Similarity:100/208 - (48%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLN 101
            :||.||.|||||..|:.|.:...||::||:||..|||||:.|::|:|.|.:|.|||::.|:.|:.
  Rat    20 LLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIE 84

  Fly   102 DAITRAKGSSKGFLIDGYPRQKNQGIE----FEARIAPADLALYFECSEDTMVQRIMAR------ 156
            ..: .......|||:||:||...|...    .:.|....|..:.|...:..:::||..|      
  Rat    85 KNL-ETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKS 148

  Fly   157 -------------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAE 200
                               .....::|.|||||.::.||..:...|..::|.|..:.:  .|:|.
  Rat   149 GRSYHEEFNPPKEAMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDAS 213

  Fly   201 RDVDDIFLEVVQA 213
            :..|.:|..::.|
  Rat   214 QTPDVVFASILAA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 62/208 (30%)
ADK 34..206 CDD:238713 60/199 (30%)
Ak2NP_112248.2 adk 17..229 CDD:234711 62/208 (30%)
ADK 17..219 CDD:238713 60/199 (30%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 45..74 14/28 (50%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168 141..178 2/36 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.