DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and Ak1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_038960159.1 Gene:Ak1 / 24183 RGDID:2076 Length:210 Species:Rattus norvegicus


Alignment Length:206 Identity:93/206 - (45%)
Similarity:134/206 - (65%) Gaps:10/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KEAEEKLKAEELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSD 76
            :|..::...::|::|:      ||:::||||.||||||.|||:|||:||||:|||||.||:|||.
  Rat    10 QEEGDRKTGDKLKKAK------IIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSS 68

  Fly    77 KGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALY 141
            :|:.|.::|..|.||..:.||.:|.||:.....||.|||||||||:..||.|||.:||...|.||
  Rat    69 RGKMLSSIMEKGELVPLETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLY 133

  Fly   142 FECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLT--INAERDVD 204
            .:...:||.||::.|...|.  |.||||:||:.||.|:.:.|..::..|:.:.:.  :|||..||
  Rat   134 VDAGPETMTQRLLKRGETSG--RVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVD 196

  Fly   205 DIFLEVVQAID 215
            .:|.:|...:|
  Rat   197 TVFSQVCTYLD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 90/188 (48%)
ADK 34..206 CDD:238713 87/173 (50%)
Ak1XP_038960159.1 aden_kin_iso1 22..209 CDD:130427 91/194 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3913
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20135
Inparanoid 1 1.050 176 1.000 Inparanoid score I3941
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0005806
OrthoInspector 1 1.000 - - otm45648
orthoMCL 1 0.900 - - OOG6_100591
Panther 1 1.100 - - O PTHR23359
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4196
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.