DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and Ak5

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_011238417.1 Gene:Ak5 / 229949 MGIID:2677491 Length:566 Species:Mus musculus


Alignment Length:174 Identity:77/174 - (44%)
Similarity:114/174 - (65%) Gaps:8/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVM 85
            |:||:.:      ||:::||||.||||||.|:.|||||||||:|:|||.|:.|.|::.:.::.:|
Mouse   371 EDLRKCK------IIFLMGGPGSGKGTQCEKLAEKYGFTHLSTGELLRQELTSESERSKLIRDIM 429

  Fly    86 ASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMV 150
            ..|.||.:..||.||.:|:..:.|::||||||||||:..||.||..||....|.:..:||.|||.
Mouse   430 ERGDLVPSGVVLELLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMT 494

  Fly   151 QRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKT 194
            .|::.|:.:|  :|.:|..|:|..||..:.:.:..::..||.||
Mouse   495 NRLLQRSQSS--QRGEDGAKSIAKRLEAYHRASIPVVTYYERKT 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 74/165 (45%)
ADK 34..206 CDD:238713 74/161 (46%)
Ak5XP_011238417.1 ADK 134..307 CDD:238713
aden_kin_iso1 374..540 CDD:130427 75/171 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3944
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43577
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.