DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AK9

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_011533852.1 Gene:AK9 / 221264 HGNCID:33814 Length:1988 Species:Homo sapiens


Alignment Length:191 Identity:57/191 - (29%)
Similarity:80/191 - (41%) Gaps:52/191 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KEAEEKL---KAEELRRARAAADIPI-IWILGGPGCGKGT-----QCAKIVEKYGFTHLSSGDLL 67
            ||.:||.   ..:.:|:.:....:|| |.|:|.|..||.|     ...||..:||..|||.|..|
Human  1459 KETKEKFMKNPIKYIRQPKPKPTVPIRIIIVGPPKSGKTTVLCFSVAKKITSEYGLKHLSIGGAL 1523

  Fly    68 RNEVASGSDKGRQLQAVMAS----GGLVSNDEV------LSLLNDAITRAKGSSKGFLIDGYPRQ 122
            |..:.:..:  .:| |:|.:    .|:.:.||:      |||:......|     |.:|||||..
Human  1524 RYVLNNHPE--TEL-ALMLNWHLHKGMTAPDELAIQALELSLMESVCNTA-----GVVIDGYPVT 1580

  Fly   123 KNQGIEFEAR-IAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQN 182
            |:|....||| |.|   .:.||.|..:                     |.|..|||..|:|
Human  1581 KHQMNLLEARSIIP---MVIFELSVPS---------------------KEIFKRLLLEKEN 1617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 52/170 (31%)
ADK 34..206 CDD:238713 51/166 (31%)
AK9XP_011533852.1 ADK 105..348 CDD:238713
Ribosomal_L24e_L24 1017..1059 CDD:321242
ADK 1065..>1233 CDD:238713
ADK 1485..>1612 CDD:238713 46/158 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.