DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AK2

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001616.1 Gene:AK2 / 204 HGNCID:362 Length:239 Species:Homo sapiens


Alignment Length:208 Identity:62/208 - (29%)
Similarity:100/208 - (48%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLN 101
            :||.||.|||||..::.|.:...||::||:||..|||||:.|::|:|.|.:|.|||::.|:.|:.
Human    20 LLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIE 84

  Fly   102 DAITRAKGSSKGFLIDGYPRQKNQGIE----FEARIAPADLALYFECSEDTMVQRIMAR------ 156
            ..: .......|||:||:||...|...    .|.|....|..:.|...:..:::||..|      
Human    85 KNL-ETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKS 148

  Fly   157 -------------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAE 200
                               .....::|.|||||.::.||..:...|..::|.|..:.:  .|:|.
Human   149 GRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDAS 213

  Fly   201 RDVDDIFLEVVQA 213
            :..|.:|..::.|
Human   214 QTPDVVFASILAA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 62/208 (30%)
ADK 34..206 CDD:238713 60/199 (30%)
AK2NP_001616.1 ADK 20..204 CDD:395329 57/184 (31%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03168, ECO:0000269|Ref.17 45..74 14/28 (50%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03168, ECO:0000269|Ref.17 141..178 2/36 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..169 0/18 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.