DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AK1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001305051.1 Gene:AK1 / 203 HGNCID:361 Length:210 Species:Homo sapiens


Alignment Length:206 Identity:96/206 - (46%)
Similarity:136/206 - (66%) Gaps:11/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EEKLKA-EELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKG 78
            |:.|:| |:|::.:      ||:::||||.||||||.|||:|||:||||:|||||:||:|||.:|
Human    12 EDDLRAREKLKKTK------IIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARG 70

  Fly    79 RQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFE 143
            ::|..:|..|.||..:.||.:|.||:.....:|||||||||||:..||.|||.||....|.||.:
Human    71 KKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVD 135

  Fly   144 CSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLT--INAERDVDDI 206
            ...:||.||::.|...|.  |.||||:||:.||.|:.:.|..::..||.:.:.  :|||..||.:
Human   136 AGPETMTQRLLKRGETSG--RVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSV 198

  Fly   207 FLEVVQAIDCV 217
            |.:|...:|.:
Human   199 FSQVCTHLDAL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 91/188 (48%)
ADK 34..206 CDD:238713 88/173 (51%)
AK1NP_001305051.1 aden_kin_iso1 22..209 CDD:130427 91/194 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3970
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20135
Inparanoid 1 1.050 179 1.000 Inparanoid score I4024
Isobase 1 0.950 - 0 Normalized mean entropy S697
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0005806
OrthoInspector 1 1.000 - - otm41526
orthoMCL 1 0.900 - - OOG6_100591
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2590
SonicParanoid 1 1.000 - - X4196
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.960

Return to query results.
Submit another query.