DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and F38B2.4

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001257141.1 Gene:F38B2.4 / 181317 WormBaseID:WBGene00009531 Length:210 Species:Caenorhabditis elegans


Alignment Length:196 Identity:106/196 - (54%)
Similarity:135/196 - (68%) Gaps:7/196 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSN 93
            ||.:||.:|:||||.||||||.|||.|||.||||||||||:||.|||.:|.||.|:|.||.||..
 Worm    17 AAGVPIFFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPL 81

  Fly    94 DEVLSLLNDAITRA--KGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMAR 156
            :.||.|:.:|:.:|  || |||||||||||:..||.:||:.|..|.|.|:|:.:|:|:|:|::.|
 Worm    82 EVVLDLVKEAMLKAIEKG-SKGFLIDGYPREVAQGQQFESEIQEAKLVLFFDVAEETLVKRLLHR 145

  Fly   157 AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAERDVDDIFLEVVQAIDCVLK 219
            |..|.  |.|||..||:.||.||..:|..:::.||.  |.:.||||..|||||..||..:|....
 Worm   146 AQTSG--RADDNADTIKKRLHTFVTSTAPVVDYYESKGKLVRINAEGSVDDIFAVVVANLDKATS 208

  Fly   220 K 220
            |
 Worm   209 K 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 104/190 (55%)
ADK 34..206 CDD:238713 96/175 (55%)
F38B2.4NP_001257141.1 aden_kin_iso1 18..206 CDD:130427 104/190 (55%)
ADK 22..195 CDD:238713 96/175 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I2386
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20135
Inparanoid 1 1.050 188 1.000 Inparanoid score I2584
Isobase 1 0.950 - 0 Normalized mean entropy S697
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 1 1.000 - - FOG0005806
OrthoInspector 1 1.000 - - oto17669
orthoMCL 1 0.900 - - OOG6_100591
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2590
SonicParanoid 1 1.000 - - X4196
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.960

Return to query results.
Submit another query.