DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and F13E6.2

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_509786.2 Gene:F13E6.2 / 181264 WormBaseID:WBGene00008746 Length:729 Species:Caenorhabditis elegans


Alignment Length:243 Identity:67/243 - (27%)
Similarity:118/243 - (48%) Gaps:36/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVMKKEAEEKLKAEELRRAR---------------AAADI----------PIIWILGGPGCGKGT 47
            |..:...:|||...:.:.|.               :||::          |:|.:||.||..|..
 Worm   464 RSRESARKEKLATPDSKNAADTRNKTSSNGSSEIVSAAELGEPVGLPNNAPVILVLGAPGSQKND 528

  Fly    48 QCAKIVEKY-GFTHLSSGDLLRNEVASGSDKGRQL----QAVMASGGLVSNDEVLSLLNDAITRA 107
            ...:|.:|| |||.||.||:||.::  .::|..::    ...|.:|..:......::|.:.:...
 Worm   529 ISRRIAQKYDGFTMLSMGDILRKKI--NNEKNDEMWDKVSKKMNNGDPIPTKMCRTVLYEELHSR 591

  Fly   108 KGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTI 172
            ..|:.|::|:|||:..:|.::.|..:...|||:..:|:|...::.|..|...:  ||.||:...:
 Worm   592 GTSNWGYVIEGYPKSPDQLVDLEHSLQRTDLAILIDCTEQFCLEVINKRNREN--KRSDDDSDAV 654

  Fly   173 RARLLTFKQNTNAILELYEP--KTLTINAERDVDDIFLEVVQAIDCVL 218
            |:|:..||:||..:|:..:.  |...::.:.|.|.:|.||||.||..|
 Worm   655 RSRMEYFKKNTLPMLKTLDDKGKLRVVDGDADPDTVFKEVVQVIDRTL 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 60/203 (30%)
ADK 34..206 CDD:238713 51/178 (29%)
F13E6.2NP_509786.2 aden_kin_iso1 168..355 CDD:130427
ADK 171..337 CDD:238713
aden_kin_iso1 514..699 CDD:130427 57/188 (30%)
ADK 515..690 CDD:238713 51/178 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.