DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and let-754

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001370509.1 Gene:let-754 / 176118 WormBaseID:WBGene00002879 Length:251 Species:Caenorhabditis elegans


Alignment Length:217 Identity:67/217 - (30%)
Similarity:111/217 - (51%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLND 102
            :|.||.|||||.....:||...||::|||||.||||||:.|::|:|.|.:|.|||::.|..|:..
 Worm    32 IGPPGSGKGTQAPAFAQKYFSCHLATGDLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQ 96

  Fly   103 AITRAKGSSKGFLIDGYPRQKNQGIE----FEARIAPADLALYFECSEDTMVQRIMAR------- 156
            .:.:.: ...||::||:||...|..:    .|.|..|.|..:.|..::|.:|:||..|       
 Worm    97 KLEKPE-CKYGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASG 160

  Fly   157 ------------------AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPK--TLTINAER 201
                              .....::|.||||:|:|.||:.:.|.|..:::.|:..  .:.::|.:
 Worm   161 RSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYKKHGVHVAVDAAK 225

  Fly   202 DVDDIFLEVVQAIDCVLKKKQQ 223
            .:.|:...:.|......:||::
 Worm   226 PMTDVKAHIDQVFAKFTQKKER 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 65/209 (31%)
ADK 34..206 CDD:238713 63/198 (32%)
let-754NP_001370509.1 ADK 31..215 CDD:395329 62/183 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.