DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and F40F8.1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001300543.1 Gene:F40F8.1 / 174701 WormBaseID:WBGene00009575 Length:228 Species:Caenorhabditis elegans


Alignment Length:196 Identity:68/196 - (34%)
Similarity:112/196 - (57%) Gaps:17/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNE-VASGSDKGRQLQAVMASGGLVSNDEVL 97
            ::::||.||.||||.||||.|...:.|||:|||||.| ...||:.|..:::.:.:|.:|..:...
 Worm    41 VVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITC 105

  Fly    98 SLLNDAITRAKGSSKGFLIDGYPRQK------NQGIEFEARIAPADLALYFECSEDTMVQRIMAR 156
            |||.:|: :|.|.:||||:||:||.:      |:.::.:|.:   ...|:..|.....::|.:.|
 Worm   106 SLLENAM-KACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALV---QFVLFLSCPVSICIERCLNR 166

  Fly   157 AAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLT--INAERDVDDIFLEVVQAIDCVLK 219
            ...    |.||||::::.|:.|:.|.|..|:|.:|...|.  :.:||.||.::.:|.:..|...|
 Worm   167 GQG----RTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFDAANK 227

  Fly   220 K 220
            |
 Worm   228 K 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 66/191 (35%)
ADK 34..206 CDD:238713 64/180 (36%)
F40F8.1NP_001300543.1 UMP_CMP_kin_fam 41..223 CDD:273576 65/189 (34%)
ADK 41..214 CDD:238713 64/180 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54223
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100591
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.