DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AK8

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_005272226.1 Gene:AK8 / 158067 HGNCID:26526 Length:491 Species:Homo sapiens


Alignment Length:214 Identity:47/214 - (21%)
Similarity:88/214 - (41%) Gaps:30/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVL 97
            |.:.:||..|.||..|.|.:.:||...::..|.||:..||..:..|..:|........|.:..::
Human   281 PRVLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKEMAVPDSLLM 345

  Fly    98 SLLNDAITRAKGSSKGFLIDGYPRQKNQ-----------------GIEFEA--------RIAPAD 137
            .:|:..:.:.....||:::.|.||..:|                 .:.|::        ||.|..
Human   346 KVLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRRIDPVT 410

  Fly   138 LALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLTINAERD 202
            ...|....:......|.||    .::...|.|:.::.::..|.:|:..:.:|| ...:|:|.::|
Human   411 GERYHLMYKPPPTMEIQAR----LLQNPKDAEEQVKLKMDLFYRNSADLEQLY-GSAITLNGDQD 470

  Fly   203 VDDIFLEVVQAIDCVLKKK 221
            ...:|..:...|...|.||
Human   471 PYTVFEYIESGIINPLPKK 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 44/208 (21%)
ADK 34..206 CDD:238713 41/196 (21%)
AK8XP_005272226.1 adk 71..270 CDD:273569
ADK 71..261 CDD:238713
adk 282..480 CDD:273569 42/202 (21%)
ADK 282..474 CDD:238713 41/196 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.