DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and AK7

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_006720084.1 Gene:AK7 / 122481 HGNCID:20091 Length:730 Species:Homo sapiens


Alignment Length:188 Identity:30/188 - (15%)
Similarity:70/188 - (37%) Gaps:61/188 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLR------------NEVAS 73
            :|.:::|....|.|. |||.|..||.:...::...|...|:...|::.            |:|..
Human   357 KEYKQSRGLMPIKIC-ILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGE 420

  Fly    74 GSDK------------GRQL-----QAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPR 121
            |.::            .::|     :::..:.|.:.:..::..:.:.:......::|:::||:|:
Human   421 GEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPK 485

  Fly   122 QKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTF 179
            ..:|                   ::|...|            .|::.|..:|.|:..|
Human   486 TYDQ-------------------AKDLFNQ------------EDEEEEDDVRGRMFPF 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 28/179 (16%)
ADK 34..206 CDD:238713 27/175 (15%)
AK7XP_006720084.1 WcaG <147..310 CDD:223528
NADB_Rossmann <149..307 CDD:304358
ADK 369..>548 CDD:238713 27/176 (15%)
Dpy-30 679..>711 CDD:253069
GVQW 713..>730 CDD:290611
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.