DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and Ak1

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_067490.1 Gene:Ak1 / 11636 MGIID:87977 Length:210 Species:Mus musculus


Alignment Length:211 Identity:98/211 - (46%)
Similarity:135/211 - (63%) Gaps:12/211 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VMKKEAEE--KLKAEELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEV 71
            |..:..||  :...|:|::|:      ||:::||||.||||||.|||:|||:||||:|||||.||
Mouse     5 VSSEPQEEGGRKTGEKLKKAK------IIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEV 63

  Fly    72 ASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPA 136
            :|||::|::|.|:|..|.||..|.||.:|.||:.....||.|||||||||:..||.|||.:|...
Mouse    64 SSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQP 128

  Fly   137 DLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTLT--INA 199
            .|.||.:...:||.||::.|...|.  |.||||:||:.||.|:...|..::..|:.:.:.  :||
Mouse   129 TLLLYVDAGAETMTQRLLKRGETSG--RVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNA 191

  Fly   200 ERDVDDIFLEVVQAID 215
            |..||.:|.||...:|
Mouse   192 EGTVDTVFSEVCTYLD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 92/188 (49%)
ADK 34..206 CDD:238713 88/173 (51%)
Ak1NP_067490.1 aden_kin_iso1 22..209 CDD:130427 93/194 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3944
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20135
Inparanoid 1 1.050 180 1.000 Inparanoid score I3986
Isobase 1 0.950 - 0 Normalized mean entropy S697
OMA 1 1.010 - - QHG54223
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005806
OrthoInspector 1 1.000 - - otm43577
orthoMCL 1 0.900 - - OOG6_100591
Panther 1 1.100 - - LDO PTHR23359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2590
SonicParanoid 1 1.000 - - X4196
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.850

Return to query results.
Submit another query.