DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ak5

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_012815974.2 Gene:ak5 / 100127649 XenbaseID:XB-GENE-5764752 Length:560 Species:Xenopus tropicalis


Alignment Length:199 Identity:77/199 - (38%)
Similarity:128/199 - (64%) Gaps:10/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELRRARAAADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVM 85
            |||::|:      :|::|||||.||||||.|:..:||.:.|:..:||::::|:.:::.:.::.:|
 Frog   369 EELKKAK------VIFVLGGPGSGKGTQCEKLAHRYGLSPLAVSELLQSDLATFTERSKLIKDIM 427

  Fly    86 ASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMV 150
            ..|..|..|.:|.::.:.::...|:|||||.||:||:..|..|||.:|:..::.||.:||.:||.
 Frog   428 EHGDQVPMDIILEIVKETMSSCLGNSKGFLFDGFPRETKQAEEFECKISKPNIVLYLDCSAETMT 492

  Fly   151 QRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAERDVDDIFLEVVQA 213
            .|:..|:.||  .|:|.|.:|||.||..:.|..|.|:..|:.|:|  .||||:..:|:||.:..|
 Frog   493 SRLQKRSKAS--HRNDINTETIRRRLEAYYQAINPIITYYDRKSLLYKINAEKSPEDVFLHICSA 555

  Fly   214 IDCV 217
            :|.|
 Frog   556 VDSV 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 72/188 (38%)
ADK 34..206 CDD:238713 67/173 (39%)
ak5XP_012815974.2 ADK 134..307 CDD:238713
aden_kin_iso1 372..559 CDD:130427 73/194 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.