DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk1 and ak5

DIOPT Version :9

Sequence 1:NP_729792.1 Gene:Adk1 / 39396 FlyBaseID:FBgn0022709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001093554.1 Gene:ak5 / 100003595 ZFINID:ZDB-GENE-030131-8256 Length:563 Species:Danio rerio


Alignment Length:187 Identity:65/187 - (34%)
Similarity:109/187 - (58%) Gaps:8/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEV---ASGSDKGRQLQAVMASGGLVSNDE 95
            :|.|:||||.||||||.||.|:|||.::|.|:|||.::   |:.:.|...:..::.:|.|...:.
Zfish   134 VILIIGGPGSGKGTQCLKIAERYGFEYVSVGELLRKKMIHNATSNRKWSLIARIITNGELAPQET 198

  Fly    96 VLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAAS 160
            .::.:...|.:...:| |.:|||:||...|.:.||.::...||.::..||...:.:|:..||...
Zfish   199 TITEIKQKIMKIPEAS-GIVIDGFPRDVGQALSFEDQVCTPDLVVFLACSNQRLKERLEKRAEQQ 262

  Fly   161 AVKRDDDNEKTIRARLLTFKQNTNAILELYEPKTL--TINAERDVDDIFLEVVQAID 215
            .  |.|||.|.|..||..||||...:::.::.|.|  |::|:||.:::|.::...:|
Zfish   263 G--RPDDNPKAIDRRLTNFKQNAIPLVKYFQEKGLIVTLDADRDEEEVFYDISMTVD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk1NP_729792.1 aden_kin_iso1 30..217 CDD:130427 65/187 (35%)
ADK 34..206 CDD:238713 63/176 (36%)
ak5NP_001093554.1 aden_kin_iso1 133..317 CDD:130427 64/185 (35%)
ADK 134..308 CDD:238713 63/176 (36%)
aden_kin_iso1 375..562 CDD:130427
ADK 379..552 CDD:238713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.