DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Ctrc

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:275 Identity:88/275 - (32%)
Similarity:130/275 - (47%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLAVIMLMM------WKPT--PTDSYAVGQSKYGRIEKFPYQVML--IGKQLWRKRILCGGTL 63
            :||:.|:..::      ..||  |..|..|...:......:|:||.|  :....||.  .|||:|
Mouse     1 MLGITVLAAILACASSCGDPTFPPNLSARVVGGEDAVPNSWPWQVSLQYLRDDTWRH--TCGGSL 63

  Fly    64 LDKRWILTAGHCTMGVTHYDVYLG--TKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVK 126
            :....:|||.||......|.|.||  ..:|||.|  |.:....:...|||::|.....||||::|
Mouse    64 ITTSHVLTAAHCINTNLTYRVGLGKYNLTVEDEE--GSVYAEVDTIYVHEKWNRLLLWNDIAIIK 126

  Fly   127 LPQDVAFTPRIQPASLPSRYRHDQF--AGMSVVASGWGAMVEMTN---SDSMQYTELKVISNAEC 186
            |.:.|..:..||.|.:|.:   |..  .......:|||.:  .||   ::.:|.....::::..|
Mouse   127 LAEPVELSDTIQVACIPEQ---DSLLPGDYPCYVTGWGRL--WTNGPIAEVLQQGLQPIVNHTTC 186

  Fly   187 AQ---EYDVVTSGVICAKGLKDETVCTGDSGGPL---VLKDTQIVVGITSFGPADGCET-NIPGG 244
            ::   .:..|...::||.|....:.|.|||||||   |......|.||.|||.:.||.| ..|..
Mouse   187 SRLDWWFIKVRETMVCAGGDGVISACNGDSGGPLNCPVEDGLWQVHGIVSFGSSRGCNTYKKPVV 251

  Fly   245 FTRVTHYLDWIESKI 259
            ||||:.|:|||:.||
Mouse   252 FTRVSAYIDWIKEKI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 78/236 (33%)
Tryp_SPc 37..255 CDD:214473 76/233 (33%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 77/241 (32%)
Tryp_SPc 30..265 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.