DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Prss22

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:242 Identity:72/242 - (29%)
Similarity:111/242 - (45%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WRKRIL------CGGTLLDKRWILTAGHCTMG----VTHYDVYLGTKSVEDTEVSGGLVLRSNK- 106
            |...||      |.|:||..||::||.||...    .:.:.|.||...:      |....||.| 
Mouse   121 WIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKL------GSPGPRSQKV 179

  Fly   107 ----FIVHERFN-PETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVV--------- 157
                .:.|.|:: .|....|||||:|...:.|:.||.|..||.          |.|         
Mouse   180 GIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPD----------SSVRLPPKTDCW 234

  Fly   158 ASGWGAM---VEMTNSDSMQYTELKVISNAECAQEY------DVVTSGVICAKGLKDE-TVCTGD 212
            .:|||::   |.:.:..::|..::.:|.:..|...|      :.:|.|::||..|:.| ..|.||
Mouse   235 IAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGD 299

  Fly   213 SGGPLV--LKDTQIVVGITSFGPADGC-ETNIPGGFTRVTHYLDWIE 256
            |||||:  :.|..::.||.|:|  :|| |.|.||.:|.:..:..|::
Mouse   300 SGGPLMCQVDDHWLLTGIISWG--EGCAERNRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 72/242 (30%)
Tryp_SPc 37..255 CDD:214473 71/239 (30%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.