DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and ctrb.2

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:246 Identity:73/246 - (29%)
Similarity:115/246 - (46%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YGRI--------EKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTH------YDVY 85
            |.||        ..:|:||.|.....:.   .|||:|:::.|::||.||.:..:|      :|..
Zfish    31 YARIVNGEEAVPHSWPWQVSLQDSTGFH---FCGGSLINEWWVVTAAHCNVRTSHRVILGEHDRS 92

  Fly    86 LGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQ 150
            ...:|::...|        .|...|..||..|..|||.|:||.........:.|..|..  .:|.
Zfish    93 SNAESIQTMTV--------GKVFKHPNFNMFTINNDILLIKLATPAKINTHVSPVCLAE--TNDN 147

  Fly   151 F-AGMSVVASGWGAMVEMTNSDS---MQYTELKVISNAECAQEY-DVVTSGVICAKGLKDETVCT 210
            | .||..|.|||| :.:....|:   :|...|.:::|.:|.:.: :.:|..::|| |....:.|.
Zfish   148 FPGGMKCVTSGWG-LTKHNAPDTPALLQQAALPLLTNEDCKRFWGNKITDLMVCA-GASGASSCM 210

  Fly   211 GDSGGPLVLKDTQI--VVGITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259
            ||||||||.:...:  :|||.|:| :..|..:.||.:.|||....|::..|
Zfish   211 GDSGGPLVCQKDGVWTLVGIVSWG-SSVCSPSSPGVYARVTKLRAWVDQTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 71/241 (29%)
Tryp_SPc 37..255 CDD:214473 70/238 (29%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 70/238 (29%)
Tryp_SPc 34..259 CDD:238113 70/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.