DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Prss41

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:324 Identity:91/324 - (28%)
Similarity:141/324 - (43%) Gaps:84/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLAVIMLMMWKP-TPTDSYAVGQSK--------------------YGRIE----KFPYQVMLI 48
            ||.|.|:.:|:.:| :..::.|.|...                    .|.||    ::|:|..|.
  Rat     9 LLLLLVVCVMLGEPGSREENQAAGLKNTDIKLLSMPCGRRNDIRSRIVGGIESVRGRWPWQASLR 73

  Fly    49 GKQLWRKRILCGGTLLDKRWILTAGHC---TMGVTHYDVYLG----TKSVEDTEVSGG------L 100
            .::..|    |||:||..||:|||.||   .:....:.|.||    ..|..:.|...|      :
  Rat    74 LRKFHR----CGGSLLSHRWVLTAAHCFRKFLDPKKWTVQLGQLTSKPSFWNREAFSGRYRVKDI 134

  Fly   101 VLRS-NKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPAS-LPSRYRHDQFAGMS-----VVA 158
            ::.| :|...|          |:||::|...|.:...|||.. |||       |.||     ...
  Rat   135 IINSEDKLKYH----------DLALLRLASSVTYNKFIQPVCVLPS-------ASMSQHQPRCWV 182

  Fly   159 SGWGAMVE----MTNSDSMQYTELKVISNAEC------AQEYDVVTSGVICAKGLKDET--VCTG 211
            :||||:.|    :.....::..::.|::.:.|      |..|.::|..|.|| |.:|.:  .|:|
  Rat   183 TGWGALQEDLKPLPPPYHLREVQVTVLNLSRCQELFSFASRYHLITRDVFCA-GAEDGSADTCSG 246

  Fly   212 DSGGPLV--LKDTQIVVGITSFGPADGC-ETNIPGGFTRVTHYLDWIESKIGSHGQVHQQYLRP 272
            |||||||  :......:||.|.|.  || ...:||.:|.|:|:.|||::.:..:|.|......|
  Rat   247 DSGGPLVCNMDGLWYQIGIVSRGV--GCGRPKLPGIYTNVSHHYDWIKTMMILNGAVRHDLALP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 79/259 (31%)
Tryp_SPc 37..255 CDD:214473 77/256 (30%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 78/260 (30%)
Tryp_SPc 55..292 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.