DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Cela3b

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_080695.1 Gene:Cela3b / 67868 MGIID:1915118 Length:269 Species:Mus musculus


Alignment Length:263 Identity:84/263 - (31%)
Similarity:122/263 - (46%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPTPTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVY 85
            :|:...|..|...:......:|:||.|..::.......|||:|:...|:||||||......|.|.
Mouse    19 QPSHNPSSRVVNGEEAVPHSWPWQVSLQYEKDGSFHHTCGGSLITPDWVLTAGHCISTSRTYQVV 83

  Fly    86 LG--TKSVEDTEVSGGLVLRSNKFIVHERFNP--ETAANDIALVKLPQDVAFTPRIQPASLPSRY 146
            ||  .:.||:.: ...:.:.:....||.::|.  .:..||||||||.:.......:|.|.||.  
Mouse    84 LGEHERGVEEGQ-EQVIPINAGDLFVHPKWNSMCVSCGNDIALVKLSRSAQLGDAVQLACLPP-- 145

  Fly   147 RHDQFA------GMSVVASGWGAMVEMTNS---DSMQYTELKVISNAECAQ----EYDVVTSGVI 198
                 |      |.....||||.:  .||.   |.:|...|.|:....|::    ...|.|: ::
Mouse   146 -----AGEILPNGAPCYISGWGRL--STNGPLPDKLQQALLPVVDYEHCSRWNWWGLSVKTT-MV 202

  Fly   199 CAKGLKDETVCTGDSGGPL---VLKDTQIVVGITSFGPADGCET-NIPGGFTRVTHYLDWIESKI 259
            ||.| ..::.|.|||||||   ....|..|.|:|||..:.||.| ..|..||||:.::||||..|
Mouse   203 CAGG-DIQSGCNGDSGGPLNCPADNGTWQVHGVTSFVSSLGCNTLRKPTVFTRVSAFIDWIEETI 266

  Fly   260 GSH 262
            .::
Mouse   267 ANN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 80/241 (33%)
Tryp_SPc 37..255 CDD:214473 77/238 (32%)
Cela3bNP_080695.1 Tryp_SPc 27..262 CDD:214473 78/246 (32%)
Tryp_SPc 28..265 CDD:238113 81/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.